PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN19304.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 353aa    MW: 38695.1 Da    PI: 7.3958
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN19304.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1261.2e-3955113462
      zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                  alkcprC+st+tkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rknkk+s
  KHN19304.1  55 LALKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKKVS 113
                 5789****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-2947107IPR003851Zinc finger, Dof-type
PfamPF027011.8E-3356111IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.05957111IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105995IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MGLSSLHVCM DSSDHWLQGT IHEESGMDSS SSPSGDMLTC SRPMIERRLR PPHDLALKCP  60
RCESTHTKFC YYNNYSLSQP RYFCKTCRRY WTKGGTLRNI PVGGGCRKNK KVSAKKSNND  120
HQLVNNNNSP TQPPPSSSYH HHSHPKDLQL SSFPDVQFSH LSNLLGTNIA NPSFMEGKYG  180
IGMIENPRPI DFMMESKLEG IIGSGSSSRN NFDFFGNSDM SMGMTSVGLG DMNSTQNGLP  240
PNFHHHGLSA FGGMSMSMSL DHGNNNNNSG GNGGSNNYLM DSCQRLMLPY ASSNEDHNAP  300
IDVKPNPKQL LSLEWQDQGC SDAGKDSFGY LNGPGSWTGM MNGYGSSTTN PLV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572640.0DQ857264.1 Glycine max Dof14 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003527017.10.0PREDICTED: dof zinc finger protein DOF5.6-like
TrEMBLA0A0B2QGI60.0A0A0B2QGI6_GLYSO; Dof zinc finger protein DOF5.6
TrEMBLI1KCF80.0I1KCF8_SOYBN; Uncharacterized protein
STRINGGLYMA06G19330.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50923456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.15e-51Dof family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]